PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS768161.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bHLH
Protein Properties Length: 180aa    MW: 19508.9 Da    PI: 10.4462
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS768161.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH32.81.3e-10130159130
                   CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
           HLH   1 rrrahnerErrRRdriNsafeeLrellPka 30 
                   +r++h ++Er+RR+++N+ ++ Lr+l+P++
  EcS768161.10 130 QRMTHIAVERNRRKQMNEHLAVLRSLMPES 159
                   79**************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474596.69E-9122160IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.14E-7128163No hitNo description
Gene3DG3DSA:4.10.280.102.2E-9128161IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088811.63129180IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.5E-8130159IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MALDALSASD LLNFIIYDTI SVTPYSSHDS SDTTFLDSHH YHLIQPPHQE QAAAAASAAS  60
AAAGSCSLQT NSISGSPPPQ PSPPAPPPQG RRARSGEKRA AGQGAAAAQG RKKRKRRPRV  120
CKNKEEAETQ RMTHIAVERN RRKQMNEHLA VLRSLMPESY VQRGWFSSPL SLSLSLSLSL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110115RKKRKR
2110116RKKRKRR
3111116KKRKRR
4130141RMTHIAVERNRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055312.11e-115PREDICTED: transcription factor bHLH71
TrEMBLA0A059BZY01e-115A0A059BZY0_EUCGR; Uncharacterized protein
STRINGGLYMA08G36590.19e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103892535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22490.13e-21bHLH family protein